Dataset for protein Unclassified of organism Accipiter nisus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8B9M4X0_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Accipiter nisus (length=379 residues).
MPLHLFGKYATGSPFGPRKPAAPLMQRIQVRATKGGKPPPSEETARRDSAFRSTAPGNARLCAAGALPGGAGGPCGDGAP
APRQHPAGRPAGRGQARRGGGRRGEAGRAGPGPPPRPGFGFPPRRAPPRRRGALPQRPGAGWAGPGRAGPGGGAAPPRLA
SPRLLVGGSCCCGAAAMPSSLKEETALLLEDYFQHRGGGAALPPSPTAATLRRAAAELERRERPFFRSCAPLARAEPREA
AALLERVAAQLEAEGGLNWGRLLALVVFAGTLAAALTERGCGDGPRCLAAALAAYLAEERGEWLEAHGGWDGFCRFFGRH
GSQPADQSSTISNAIMAAAGFGIAGLAFLLVVRGQKRLYYRRLLISKKKATDELLQVQL
© 1998-2022Legal notice