Dataset for protein asfarviridae of organism African swine fever virus

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A0C5AZD3_LMW5HL-01 LMW5-HL protein OS=[Viruses] African swine fever virus GN=LMW5-HL (length=179 residues).
MEGEELIYHNIINEILVGYIKYYMNDISEHELSPYQQQIKKILTYYDDCLNKQVTITFSLTSAQEIKTQFTEVVTELFKD
LINWGRICGFIVFSARMAKYCKDANNHLESTVITTAYNFMKHNLLPWMISHGGQEEFLAFSLHSDIYSVIFNIKYFLSKF
CNHMFLRSCVHLLRNCNLI
>gnl|bcl2dbpro|A0A7R8V9Y5_LMW5HL-01 LMW5-HL protein OS=[Viruses] African swine fever virus GN=LMW5-HL (length=179 residues).
MEGEELIYHNIINEILVGYIKYYMNDISEHELSPYQQQIKKILTYYDDCLNKQVTITFSLTSAQEIKTQFTEVVTELFKD
LINWGRICGFIVFSARMAKYCKDANNHLESTVITTAYNFMKHNLLPWMISHGGQEEFLAFSLHSDIYSVIFNIKYFLSKF
CNHMFLKSCVHLLRNCNLI
>gnl|bcl2dbpro|A9JKY0_LMW5HL-01 LMW5-HL protein OS=[Viruses] African swine fever virus GN=LMW5-HL (length=179 residues).
MEGEELIYHNIINEILVGYIKYYINDISEHELSPYQQQIKKILTYYDECLNKQVIITFSLTSVQEIKTQFTGVVTELFKD
LINWGRICGFIVFSAKMAKYCKDANNHLESTVITTAYNFMKHNLLPWMISHGGQEEFLAFSLHSDMYSVIFNIKYFLSKF
CNHMFFRSCVQLLRNCNLI
>gnl|bcl2dbpro|A9JLP1_LMW5HL-01 LMW5-HL protein OS=[Viruses] African swine fever virus GN=LMW5-HL (length=179 residues).
MEGEELIYHNIINEILVGYIKYYINDISEHELSPYQQQIKKILTYYDECLNKQVTITFSLTSVQEIKTQFTGVVTELFKD
LINWGRICGFIVFSAKMAKYCKDANNHLESTVITTAYNFMKHNLLPWMISHGGQEEFLAFSLHSDMYSVIFNIKYFLSKF
CNHMFFRSCVQLLRNCNLI
>gnl|bcl2dbpro|D0Q0E8_LMW5HL-01 LMW5-HL protein OS=[Viruses] African swine fever virus GN=LMW5-HL (length=179 residues).
MEGEELIYHNIINEILVGYIKYYINDISEHELSPYQQQIKKILTYYDECLNKQVTITFSLTSVQEIKTQFTGVVTELFKD
LINWGRICGFIVFSAKMAKYCKDANNHLESTVITTAYNFMKHNLLPWMISHGGQEEFLAFSLHSDMYSVIFNIKYFLSKF
CNHMFFRSCVQLLRNCNLI
>gnl|bcl2dbpro|D4I5M9_LMW5HL-01 LMW5-HL protein OS=[Viruses] African swine fever virus GN=LMW5-HL (length=179 residues).
MEGEELIYHNIINEILVGYIKYYINDISEHELSPYQQQIKKILTYYDECLNKQVTITFSLTSVQEIKTQFTGVVTELFKD
LINWGRICGFIVFSAKMAKYCKDANNHLESTVITTAYNFMKHNLLPWMISHGGQEEFLAFSLHSDMYSVIFNIKYFLSKF
CNHMFFRSCVQLLRNCNLI
>gnl|bcl2dbpro|P42485_LMW5HL-01 LMW5-HL protein OS=[Viruses] African swine fever virus GN=LMW5-HL (length=179 residues).
MEGEELIYHNIINEILVGYIKYYINDISEHELSPYQQQIKKILTYYDECLNKQVTITFSLTSVQEIKTQFTGVVTELFKD
LINWGRICGFIVFSAKMAKYCKDANNHLESTVITTAYNFMKHNLLPWMISHGGQEEFLAFSLHSDMYSVIFNIKYFLSKF
CNHMFFRSCVQLLRNCNLI
© 1998-2022Legal notice