Dataset for protein E1B 19K of organism unidentified adenovirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8G1GLF6_E1B19K-01 E1B19K protein OS=[Viruses] unidentified adenovirus GN=E1B19K (length=165 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVXEEEEENLRAGLD
PQTEL
© 1998-2022Legal notice