Dataset for protein Unclassified of organism Squirrel monkey adenovirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6B9XJN8_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Squirrel monkey adenovirus (length=230 residues).
MDLLKFLEDFGNCRRVLLEASNRTGSWGRWLLSDQVVRTVHQVKRDYGSHFERLLQEENNQLLNNLELGNTRPLRSVLRE
LEFENTGRVIAGLAFLVYLLDRWDENTSLSPGYTLDCLALAIWKHALREGIMQGVTRLPRARVSAGLRQEMEERLTQVQR
AIEERQREREQRELAVQLEEREEEGATMSTWRPSPREERDPAWNPRAGLDPEPEGPLEEELQQAARDPVL
© 1998-2020Legal notice