Dataset for protein Unclassified of organism Skunk adenovirus HUN 2009

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A7D3UMS6_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Skunk adenovirus HUN/2009 (length=182 residues).
MDILQLCSSYSQFRGIIRGTTYRAGWVRRWCFHPLTDIVANLAEDFDTRYWLALPLGHPYWELLKRGYTFAGNPDLFGGV
DLSTRGRALAFLGFLTFILRNWPPDSVVPSEARIDLVCVPAWTKIQMWTQTLKLLEEMQTARAMPEEEEEGLTSPSDEEV
ASDSTDQPDPHSDEDPFPPETE
© 1998-2021Legal notice