Dataset for protein Unclassified of organism Porcine mastadenovirus B

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A5P9VJA7_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Porcine mastadenovirus B (length=152 residues).
MDLLDHILADYSYLRHLVQQTAKGLSWWQRYLWGSALLVTVEDILRAHESSFGAFDHVQQACDDLRSGDPTAVLEQILPV
VPLHTPGHVLTAIAFCAYLVRRCSIGTPLTPGFILDTICLHLWLMLRRDAFRRNHGTSPDFSLQDAIPPHLE
>gnl|bcl2dbpro|A0A7H0S529_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Porcine mastadenovirus B (length=152 residues).
MDLLDHILADYSYLRHLVQQTAKGLSWWQRYLWGSALLVTVEDILQKHESSFGAFDHVQQACDDLRSGDPTAVLEQILPV
VPLHTPGHVLTGIAFCAYLVRRCSIGTPLTPGFILDTICLHLWLMLRRDAFRRDHGTSPDFSLEDAIRPHLE
© 1998-2022Legal notice