Dataset for protein Unclassified of organism Ovine adenovirus 8

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A5B8MCV5_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Ovine adenovirus 8 (length=147 residues).
MDFLLVLLDLRLLRSVVAGASARTGEWKRRLWLGRLTQLVHRTCEEQRESFLRSLPGNDAFLRLLRDGRFEVYDTYVVPE
LRLQTPGQIVACLALLVFLLNDLDAHAAPLHGFDPGFLVDRLCVPVWQRAKAFRAVEQSSKSASPPS
© 1998-2020Legal notice