Dataset for protein adenoviridae of organism Human adenovirus A serotype 12

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3G8WH01_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus A serotype 12 GN=E1B19K (length=163 residues).
MELETVLQSFQSVRQLLQYTSKNTSGFWRYLFGSTLSKVVNRVKEDYREEFENILADCPGLLASLDLCHHLVFQEKVVRS
LDFSSVGRTVASIAFLATILDKWSEKSHLSWDYMLDYMSMQLWRAWLKRRVCIYSLARPLTMPPLPTLQEEKEEERNPAV
VEK
>gnl|bcl2dbpro|P04492_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus A serotype 12 GN=E1B19K (length=163 residues).
MELETVLQSFQSVRQLLQYTSKNTSGFWRYLFGSTLSKVVNRVKEDYREEFENILADCPGLLASLDLCYHLVFQEKVVRS
LDFSSVGRTVASIAFLATILDKWSEKSHLSWDYMLDYMSMQLWRAWLKRRVCIYSLARPLTMPPLPTLQEEKEEERNPAV
VEK
>gnl|bcl2dbpro|P04492_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus A serotype 12 GN=E1B19K (length=482 residues).
MEREIPPELGLHAGLHVNAAVEGMAEEEGLHLLAGAAFDHAAAADVARGEGGGAEPCGGGEVNMEQQVQEGHVLERGEGP
SCADDRDKQEKKESLKEAAVLSRLTVNLMSRPRLETVYWQELQDEFQRGDMHLQYKYSFEQLKTHWLEPWEDMECAIKAF
AKLALRPDCSYRITKTVTITSCAYIIGNGAEVEVDTSDRVAFRCRMQGMGPGVVGLDGITFINVRFAGDKFKGIMFEANT
CLVLHGVYFLNFSNICVESWNKVSARGCTFYGCWKGLVGRPKSKLSVKKCLFEKCVLAILNEGDAHIRHNAASENACFVL
LKGMAILKHNMVCGVSDQTMRRFVTCADGNCHTLKTVHIVSHSRHCWPVCDHNMFMRCTIHLGLRRGMFRPSQCNFSHSN
IMLEPEVFSRVCLNGVFDLSVELCKVIRYNDDTRHRCRQCECGSSHLELRPIVLNVTEELRSDHLTLSCLRTDYESSDED
DN
© 1998-2022Legal notice