Dataset for protein E1B 19K of organism Human adenovirus 7d

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A897JQR0_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 7d GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILNYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|A0A897JQR0_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 7d GN=E1B19K (length=492 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLKLLASAASRSSRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARIRH
CAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
© 1998-2022Legal notice