Dataset for protein E1B 19K of organism Human adenovirus 27

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|M0QUN2_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 27 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QUN2_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 27 GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
© 1998-2022Legal notice