Dataset for protein adenoviridae of organism Human adenovirus 19a

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A7R6T9I9_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 19a GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELN
© 1998-2022Legal notice