Dataset for protein Unclassified of organism Guinea pig adenovirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6H1TFX1_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Guinea pig adenovirus (length=228 residues).
MELAEYLENFAVLRRVLYQSSDRYGDWWRWLTGYKLARLVHEVRAEHRYSFEALCGDEVLQRLLRDQGRRLEPFFHSVLD
FSTAGRSVTSLAFAVHVLGALTRDGRGQPLSDDFWLDTVCVAVHRAICLTLQCHRRRSRGSRGARRREASSGSLDLADAL
PQPPPSPPSSTVTAQVERMQRRDSSRGMDAEGAAEAAEATAAATQRREEQVRRALRSDLSTTPRRGAF
© 1998-2020Legal notice