Dataset for protein Unclassified of organism Bat mastadenovirus

[Download (right click)]

5 sequence(s)

>gnl|bcl2dbpro|A0A3G9ET96_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat mastadenovirus (length=172 residues).
MDPLSACNSYDSFRHMIRGSLLPPGWIRRWCLSSLSDIVGTISVSSEARFTYSLPDDHLFWSLFKKGFTIGCCNELFEPV
DLSNRGRVLAFFAFVSFLLRKWPADSVVPQGERLDLICVPAWSRMQLWKQATAVLEKEDEEDKAEADDDSEEETLVEQSG
TDTGDSDEALRE
>gnl|bcl2dbpro|A0A894JCI7_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat mastadenovirus (length=150 residues).
MDILNPITSFECLRKIIKGSSCEVSDWGRLLWYPRLSTLVYRVKLHYLEELSNLLPSDGTLWQDLYSLNTFPLNFMLGEI
DLQNRGRCLAAFALVSFILDRWDCTDVDYKLDLLIAPLWQRIIKEKMKNSGCMLLCSSTCEKDLYLLDQD
>gnl|bcl2dbpro|A0A894JF83_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat mastadenovirus (length=179 residues).
MDLLRACSTYSAFKYMMKGSTYNSGWVRRWCFPGLSEVVGTLAETHSYRFWNMMPRRHLYWDLVRRGYCTSFFEIMFRKA
DLSNRGRVLAYLAFVSFLLRNWPQDSVVPEADRLDLICIPAWTRMQSWQQTVTLMQEIEETQQGTGAEECTDAEQAFVEE
EEQGGGSSPDPLTEGSMQP
>gnl|bcl2dbpro|A0A894JI46_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat mastadenovirus (length=175 residues).
MDILSLCNNYSTFKNIVRGSTYGPGLVRRWCFPALSDIVGTIAEENAYRFWGVMPSSHIYWDFVKRGYCTSFFQTMFHMA
DLSNRGRLLAFLAFVCFLLKNWPKGSVVPEADRLDLICVPAWSRLQLWQQTMTIMQQLEEDQQETGGEECGDDEMEGEEE
EELEGGDSDHLLIED
>gnl|bcl2dbpro|A0A894JJY3_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat mastadenovirus (length=181 residues).
MDLLRACSTYSAFKYMMKGSTYNSGWVRRWCFPGLSEVVGTLAETHSYRFWNMMPRRHLYWDLVRRGYCTSFFEIMFRKA
DLSNRGRVLAYLAFVSFLLRNWPQDSVVPEADRLDLICIPAWTRMQSWQQTVTLMQEIEETQQGTGAEECTDAEQAFVEE
EEEEQGGGSSPDPLTEGSMQP
© 1998-2022Legal notice