Dataset for protein Unclassified of organism Bat mastadenovirus B

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4Y5T100_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat mastadenovirus B (length=181 residues).
MDLLRACSTYSAFKYMMKGSTYNSGWVRRWCFPGLSEVVGTLAETHSYRFWNMMPRRHLYWDLVRRGYCTSFFEIMFRKA
DLSNRGRVLAYLAFVSFLLRNWPQDSVVPEADRLDLICIPAWTRMQSWQQTVTLMQEIEETQQGTGAEECTDAEQAFVEE
EEEEQGGGSSPDPLTEGSMQP
© 1998-2020Legal notice