Dataset for protein Unclassified of organism African pygmy hedgehog adenovirus 1

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4Y6HU67_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] African pygmy hedgehog adenovirus 1 (length=182 residues).
MDILQLCSSYSQFRGIIRGTTYRAGWVRRWCFHPLTDIVANLAEDFDTRYWLALPLGHPYWELLKRGYTFAGNPDLFGGV
DLSTRGRALAFLGFLTFILRNWPPDSVVPSEARIDLVCVPAWTKIQMWTQTLKLLEEMQIARAMPEEEEEGLTSPSDEEV
ASDSTDQPDPHSDEDPFPPETE
© 1998-2020Legal notice