Dataset for protein Mcl-1 of organism Vombatus ursinus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4X2LDA7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Vombatus ursinus GN=MCL-1 (length=355 residues).
MLGPFKKNAVIGLNLYCGGASAPSSGSPLLVPGKGTTVESSAPRRDGGEVEAGTTTTSAAAAAAGELISGSGGASLPDLV
PGVRGPPRTALIGAEVPDVTATTPGPLFFSRSCRFSLPAAGAADAVTSPEDELDGYEPEPPGKRPARRSLLALPLAREGG
DTSSSAHGSLPSTPPSVEEEEDELYEQSLELITWYLREQAAGTKDAKPLRSGKALETLRRVADGVQRNHETAFQGMLRKL
DIKNEEDIKAVSRVVTCVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESLTDVLVKTKRDWLIKQKGWEGF
VEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2020Legal notice