Dataset for protein Bcl2l10 of organism Vombatus ursinus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4X2K2M5_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Vombatus ursinus GN=BCL2L10 (length=188 residues).
MDYKCALREETAQLVADYLDYCCRREGFQERPPTTPAAATMRSVAKELRRRYQDFFECAQNQLLDQSPEQVIIEVAELMS
QGEFNWGRVAVLVVFAGALLEMEEPQKEERVQPLRREMSRRLTEELCNYLVEKKGAWLQEHGGWTGFHHHFTQKQSSPQS
DPSSTLCCIMAAAAGFGLVGLALLLAVR
© 1998-2020Legal notice