Dataset for protein Bcl-2 of organism Vombatus ursinus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4X2L5Q0_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Vombatus ursinus GN=BCL-2 (length=256 residues).
MAHPGRRGYDNREIVMKYIHYKLSQRGYEWDAGNLRAPASPSLPSVVASAPAVGVFSTQPRHTPLPAEPQDLATSTTAAA
RNSPLPPPPAVAAATAAAGPAVSPVPPVVHLTLRQAGDDFSRRYRRDFDEMSGQLHLTPVTARGRFATVVEELFRDGVNW
GRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHNWIQDNGGWVAKVFSMFSFTFLSPFPFTPHWTTPFHQR
GFKVLLQVKHLLTCAF
© 1998-2020Legal notice