Dataset for protein Unclassified of organism Takifugu rubripes

[Download (right click)]

4 sequence(s)

>gnl|bcl2dbpro|H2RZ55_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes (length=165 residues).
MSNRELVENCLIYKLSQKYPGTVSPPAGTGREALNAALRSMANKYERDFMEQAGDLSPYVAVTRNKAGFNKVMDDMFRDE
INWGTVVGLFVVGGATYVQSFEGGASEPVCHVADWMTDYLDQRINPWIESQGGWVTFSTPTHQSVTVSLCVGIVLLNPLL
TRFIF
>gnl|bcl2dbpro|H2SIR7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes (length=215 residues).
MSNRELVENYLIYKLSQKNYSGTLLRPKGASSGLLVDRESSGTSPSTGTGREAVIAALRSMANKFEQDFIQLAGDLSSYV
AMTRNQASFNKVMDDMFRGEINWGTVVGLFVVGGAICVQSVEGDASEPVCHIADWMAAYLDKRINPWIESQGGWVSVKER
DSKYSFLCAAPAQSQEERRKWILGGLVVLAGVLIIVTKNYGTLRKAFSHFMSYWS
>gnl|bcl2dbpro|H2UHW0_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes (length=211 residues).
MSNRELVENYLIYKLSQKNYPGTLLRPKDALSGLLVDRESSGTSPSTGTGREDVNAALWSMANKFEQDFIQLAGDLSSYG
AMTRNQASFNKVMDNMFSDEINWGTVVGLFVVGGAICGQSVEGDASEPVCHIADWMAAYLDKRINPWIESQGGWDCFAAI
YGEEACTNRAQEERHKWILGELVVLAGVLIIFTKNYGTLRNAFSHFMSYWS
>gnl|bcl2dbpro|H2UHW1_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Takifugu rubripes (length=209 residues).
QTPGETDGEAMLMQIFGRVFYLLNIDFFSPCTLLRPKDASSGLLVDRESSGTSPSAGTGREAVIAALRSMANKFEQDFIQ
LAGDLSSYGAVTRNQASFNKLMDNMFSDEINWGTIVGLFVVGGAICVQSVEGSASQPVCHIADWMTVYLDKRINPWIENQ
GGWVSVKERDSKYSFLCAAVRDLMTKIQPLFFFFRMTNGHELIRGIVFI
© 1998-2020Legal notice