Dataset for protein Bfl1 of organism Suricata suricatta

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A673TDC6_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Suricata suricatta GN=BCL2A1 (length=316 residues).
MADGEFGFVLTLAQDYMGHVLQVPPPQPSRASEVLQGVASSVQGEVEEKLRPWLDTVSVVSVDAARTVFQQVMEKEFEDG
VVNWGRIVTVFAFEGVLLKKLLRERAAPDVDARTVSHFVAEFVVRHTGEWIRQNGGWVIAHSQYQKSNRISIFLSMQDEV
ETEEIIRDIFRQGKACFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSHGFSDVTSHDFSDIIASRDFSDVITSH
GFSDIITSHDFSDVFTSHDFSDVITSQGFSDVITSHDFSDVFASHDFSDVMASHGFSDVITSHGFSDVITYFPRSQ
© 1998-2020Legal notice