Dataset for protein Unclassified of organism Strongylocentrotus purpuratus

[Download (right click)]

8 sequence(s)

>gnl|bcl2dbpro|A0A7M7GIY1_uncBCL2L1-06 Putative BCL2-like 1 protein OS=[Eukaryota] Strongylocentrotus purpuratus (length=251 residues).
MARDEMNKMNDSETTKLIEDYCIHRIRKESIELASYQHVSREPYAPVAARMREIGEEIERTNPDFFSGCCEELNISETTA
YAKFKDLADELFKDQENGSRGKGVTWGRIAALIAFSGRLSVHCASNNLEDLVPSIIGWTSRYIGSKLLPWMQDHQNWDGF
MAFFEENGKVRARETVSSIMSSACRFAVFGAGIAALACLLRRIQKDGFMDFFDRNQAAERAQESLTKFVRSACGYAVVGA
GIAALGMFLRR
>gnl|bcl2dbpro|A0A7M7GIY1_uncBCL2L1-05 Putative BCL2-like 1 protein OS=[Eukaryota] Strongylocentrotus purpuratus (length=201 residues).
MARDEMNKMNDSETTKLIEDYCIHRIRKESIELASYQHVSREPYAPVAARMREIGEEIERTNPDFFSGCCEELNISETTA
YAKFKDLADELFKDQENGSRGVTWGRIAALIAFSGRLSVHCASNNLEDLVPSIIGWTSRYIGSKLLPWMQDHQNWDGFMD
FFDRNQAAERAQESLTKFVRSACGYAVVGAGIAALGMFLRR
>gnl|bcl2dbpro|A0A7M7GIY1_uncBCL2L1-07 Putative BCL2-like 1 protein OS=[Eukaryota] Strongylocentrotus purpuratus (length=206 residues).
MARDEMNKMNDSETTKLIEDYCIHRIRKESIELASYQHVSREPYAPVAARMREIGEEIERTNPDFFSGCCEELNISETTA
YAKFKDLADELFKDQENGSRGKGVKSVTWGRIAALIAFSGRLSVHCASNNLEDLVPSIIGWTSRYIGSKLLPWMQDHQNW
DGFMDFFDRNQAAERAQESLTKFVRSACGYAVVGAGIAALGMFLRR
>gnl|bcl2dbpro|A0A7M7GIY1_uncBCL2L1-03 Putative BCL2-like 1 protein OS=[Eukaryota] Strongylocentrotus purpuratus (length=249 residues).
MARDEMNKMNDSETTKLIEDYCIHRIRKESIELASYQHVSREPYAPVAARMREIGEEIERTNPDFFSGCCEELNISETTA
YAKFKDLADELFKDQENGSRGVTWGRIAALIAFSGRLSVHCASNNLEDLVPSIIGWTSRYIGSKLLPWMQDHQNWDGFMA
FFEENGKVRARETVSSIMSSACRFAVFGAGIAALACLLRRIQKDGFMDFFDRNQAAERAQESLTKFVRSACGYAVVGAGI
AALGMFLRR
>gnl|bcl2dbpro|A0A7M7GIY1_uncBCL2L1-04 Putative BCL2-like 1 protein OS=[Eukaryota] Strongylocentrotus purpuratus (length=254 residues).
MARDEMNKMNDSETTKLIEDYCIHRIRKESIELASYQHVSREPYAPVAARMREIGEEIERTNPDFFSGCCEELNISETTA
YAKFKDLADELFKDQENGSRGKGVKSVTWGRIAALIAFSGRLSVHCASNNLEDLVPSIIGWTSRYIGSKLLPWMQDHQNW
DGFMAFFEENGKVRARETVSSIMSSACRFAVFGAGIAALACLLRRIQKDGFMDFFDRNQAAERAQESLTKFVRSACGYAV
VGAGIAALGMFLRR
>gnl|bcl2dbpro|A0A7M7GIY1_uncBCL2L1-08 Putative BCL2-like 1 protein OS=[Eukaryota] Strongylocentrotus purpuratus (length=246 residues).
MNDSETTKLIEDYCIHRIRKESIELASYQHVSREPYAPVAARMREIGEEIERTNPDFFSGCCEELNISETTAYAKFKDLA
DELFKDQENGSRGKGVKSVTWGRIAALIAFSGRLSVHCASNNLEDLVPSIIGWTSRYIGSKLLPWMQDHQNWDGFMAFFE
ENGKVRARETVSSIMSSACRFAVFGAGIAALACLLRRIQKDGFMDFFDRNQAAERAQESLTKFVRSACGYAVVGAGIAAL
GMFLRR
>gnl|bcl2dbpro|A0A7M7RC53_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Strongylocentrotus purpuratus (length=255 residues).
MSEEDRKTEGESGIWCCLGWSGGCDRAPNTNMTESILAASSPQKSNYNKQLGQNLFFNGNVRKEQPPSPDEEVNGHPLVE
EGESGLIARQLGDDYISYKVGKQHGRRPPCQHAETLRRVGDEVEERYAITLNGLVNNLEYDPDKDGEEAFTASLNAMFEE
GSCNWGRVVMVYVFAARLAKYCQENGKGYHVGSLADFAGRYVASRLTPWINKQGGWEKFDESFKAKDWKEKAAFNSLLVT
GAFLGGLAALRLLMK
>gnl|bcl2dbpro|A0A7M7T0Z6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Strongylocentrotus purpuratus (length=198 residues).
MPDISTASIVADYLRYRLQCLGNGVDAEENDCLSTIMSSVENVPEDLHEAIVNLSEKLMNDYRDSFSDMPNQLKITENTI
SSTFKAVTSELFVDGVISWGRIVAFFSFGGALCEWCQEKDIPRAFPTVEELMVAYINSHLITWIHANGGWDGLVDFYKHL
SHSSLDDSALTNGVWSGKQLVGVATLGILTVGAFFFRS
© 1998-2022Legal notice