Dataset for protein Bcl-2 of organism Strigops habroptila

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A672TR23_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Strigops habroptila GN=BCL-2 (length=242 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPLPPGLSPPAAAAAAAVAAAAGTSSDHTGLVSPHPEPPGSAAA
SHAPLAEGLRPAPQVVHLTLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVM
CVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLG
HK
© 1998-2020Legal notice