Dataset for protein Unclassified of organism Sphaeramia orbicularis

[Download (right click)]

7 sequence(s)

>gnl|bcl2dbpro|A0A672Z148_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Sphaeramia orbicularis (length=137 residues).
MTIVAKSFAIYMLNVQVLYVTPVDTMLDITPDTAYQSFKSVMDEVFKDGVNWGLLCVECAEKGHDELVPRIADWMTTYLD
EHISPWLRAQEDSFVEILDKSAAAEARRSGETLKRWLLVGVVLLTGVLIGVLVAKKQ
>gnl|bcl2dbpro|A0A673BH98_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sphaeramia orbicularis (length=222 residues).
MSASYNSRHMVEDYLRYKLLQKGVAWRLPSPRRPAEALSLERTSVLHRGGATATTEEEEGEEERVRRDPHLAPPRLQVVL
RCAGDELERCYRDDLSAQVSALMPHDGGSVRRNLAAVREEVFRDGVNWGRIVALMELGGAVSAELARRGGASQVDDVAGW
MEESLDSPTLRGWIEDNGGWNAFVDLYGDSRPEAGLWSLRTVCGLVLLGAAGITLGALFTHQ
>gnl|bcl2dbpro|A0A673CRQ7_uncBCL2-03 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sphaeramia orbicularis (length=359 residues).
MSSEEALSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECY
RQGAFITLVARDEAKLLQAKKEVEKFAINDKQVVLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGTSISGKFEEV
EVDRFKKLMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTV
AYPPDTDTPGLAEENKTKPLETKLISETSGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQ
IVTMGLFRTIALFYLGSFDSIVRRCMIQREQSKAADKRE
>gnl|bcl2dbpro|A0A673CRQ7_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sphaeramia orbicularis (length=338 residues).
MLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDEAKLLQAKKEVEKFA
INDKQVVLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGTSISGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTM
KERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISE
TSGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQDAFVELYDRQRDSVFSCSWPSIKTVFG
LAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A673CRQ7_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sphaeramia orbicularis (length=227 residues).
MEYNRNIVEKYICHKLSKRGYAWGFHDVRDEDAANNGSIVAPSPTLVRRCREANTGPDTDSIPPLLCKRLPQSDPHADIH
RVLREAGDELERLYQPDFTEMSRQLYLSSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECAAKEDMTSQVDNI
AEWMTEYLNGPLNSWIQDNGGWDAFVELYDRQRDSVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A673CRQ7_uncBCL2-04 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sphaeramia orbicularis (length=297 residues).
MLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDEAKLLQAKKEVEKFA
INDKQVVLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGTSISGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTM
KERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISE
TSGVCQPDQVAKIIVRDAIVTMGLFRTIALFYLGSFDSIVRRCMIQREQSKAADKRE
>gnl|bcl2dbpro|A0A673CRQ7_uncBCL2-05 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sphaeramia orbicularis (length=186 residues).
MSSEEALSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECY
RQGAFITLVARDEVVLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGTSISGKFEEVEVDRFKIVTMGLFRTIALF
YLGSFDSIVRRCMIQREQSKAADKRE
© 1998-2020Legal notice