Dataset for protein Unclassified of organism Sparus aurata

[Download (right click)]

8 sequence(s)

>gnl|bcl2dbpro|A0A671TM16_uncMCL1-02 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sparus aurata (length=196 residues).
MKTLQTQQESGDVAEDGDNKAVDTETRQLMQHFLSEFVGTRKPRWDESKALSTMKRVVGEVLEKHRYVYNGMLNKLSLDH
RGDDVGFISSVATILFAYGTTNWGRIASLTAFRAVLCLYFKEKGRDNCVELVGEEISNYLLTEQTDWLVENDSWHGFVEF
FRVAEPESTLRNTLVTVAGFGIGHLIKRKVVSVHTL
>gnl|bcl2dbpro|A0A671TM16_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sparus aurata (length=309 residues).
MDSLLTFTLFFFVWLWNSCHFFLTAPQSRRLHGLEGDIFSCCQTSSTKTPISSAVNDGARLFLLLPVSSILTCVSAYLQG
YICANGLDCYLDTPVGTHTHPRTHTPPHTRYMRTVDTETRQLMQHFLSEFVGTRKPRWDESKALSTMKRVVGEVLEKHRY
VYNGMLNKLSLDHRGDDVGFISSVATILFAYGTTNWGRIASLTAFRAVLCLYFKEKGRDNCVELVGEEISNYLLTEQTDW
LVENDSWHGFVEFFRVAEPESTLRNTLVTVAGFGIGATLTLLIMLSIRCTLDSPAGCTTLFLHMKLLWK
>gnl|bcl2dbpro|A0A671U992_uncMCL1-04 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sparus aurata (length=198 residues).
MFGLQLLQEAGSETNKGGNTASASEPVLRYPEDEALETVTRQLMKSFLGEFTGLLKPMPHRSKALWTMRRVVDDILETHK
CDYNGMIDQLSLDSRDNVEFVSAVANSLFSDGTSNWCRVASLTAFGAVVCQYFKDKGKDSYVEMVGDEIALYLLTKQKDW
LIDNNSWDGFVGYFRPADSTSTLMNIITVFSCANNIYW
>gnl|bcl2dbpro|A0A671U992_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sparus aurata (length=343 residues).
MAFPEYLMYSTGGYVMLDAVKYCIICACPEREHDLESCLDMRDRLKKRLKDLKLPVPIDNIPLFGTTLDPGLECDGTLVD
TRENNKFLVLGDPANMYHLEPTTDTHRCFMCTITVKDFVENDTLLGEHIYHAYTQGKDCPYLIKRFKGNHSGSETNKGGN
TASASEPVLRYPEDEALETVTRQLMKSFLGEFTGLLKPMPHRSKALWTMRRVVDDILETHKCDYNGMIDQLSLDSRDNVE
FVSAVANSLFSDGTSNWCRVASLTAFGAVVCQYFKDKGKDSYVEMVGDEIALYLLTKQKDWLIDNNSWDGFVGYFRPADS
TSTLMNIITVFAGVGIMLTLLNM
>gnl|bcl2dbpro|A0A671U992_uncMCL1-02 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sparus aurata (length=188 residues).
PQLWLSFTSVLKMFGLQLLQEAGSETNKGGNTASASEPVLRYPEDEALETVTRQLMKSFLGEFTGLLKPMPHRSKALWTM
RRVVDDILETHKCDYNGMIDQLSLDSRDNVEFVSAVANSLFSDGTSNWCRVASLTAFGAVVCQYFKDKGKDSYDGFVGYF
RPADSTSTLMNIITVFAGVGIMLTLLNM
>gnl|bcl2dbpro|A0A671U992_uncMCL1-03 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sparus aurata (length=182 residues).
VFCHVIKAYIVFNLVSGLAALQLMKSFLGEFTGLLKPMPHRSKALWTMRRVVDDILETHKCDYNGMIDQLSLDSRDNVEF
VSAVANSLFSDGTSNWCRVASLTAFGAVVCQYFKDKGKDSYVEMVGDEIALYLLTKQKDWLIDNNSWDGFVGYFRPADST
STLMNIITVFAGVGIMLTLLNM
>gnl|bcl2dbpro|A0A671X3I9_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sparus aurata (length=214 residues).
MRRYLGGYSGEQQVLKMLGLQRLRVTGSETNKGGNTSPASEPVLRYPDDKALDTVTRQLMKSFLGEFTGLLKPTPHRSKA
LWTMKRVVDDILKTHKCEYNGMIDQLSLDKRDTVTFVSAVANSLFSDGTSNWGRVASLTAFGAVVCQYFKDKGRDSHVEM
VAEELASYLLTKQKDWLINNNYWVGGCVARVQHLTKLYTWPLGCSMLSASLQST
>gnl|bcl2dbpro|A0A671X3I9_uncMCL1-02 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sparus aurata (length=203 residues).
MTVSFVCIHHACVWLSTQWHHVLKMLGLQRLRVTGSETNKGGNTSPASEPVLRYPDDKALDTVTRQLMKSFLGEFTGLLK
PTPHRSKALWTMKRVVDDILKTHKCEYNGMIDQLSLDKRDTVTFVSAVANSLFSDGTSNWGRVASLTAFGAVVCQYFKDK
GRDSHVEMVAEELASYLLTKQKDWLINNNYWVGGMLSASLQST
© 1998-2020Legal notice