Dataset for protein Unclassified of organism Sinocyclocheilus rhinocerous

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A673IHA8_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous (length=229 residues).
MANEIRYDNRNIVEKYLNHKLSKKGYEWKFQSSGEDDDTINTGVEDSSPNSGRRLQAPSAGGGNNSECLIANRVTRSDPY
SRIYGALREAGDQIERMHQREFEEMSHQMIFSPNAAQRSFLAVAEELFKDGVNWGRIVAFFEFGGTMCVESFNREMASQV
DNIAHWMTDYLNGPLENWIEENGGWDAFVELYGQQRDSMFHPLSYLTKVLGLAALGLAGVTIGAFFAQK
>gnl|bcl2dbpro|A0A673LRC6_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous (length=217 residues).
MTYRARFPLKTPETFSRLVKYIHHKLWKKGYVWEEDRGGSRHDPFSALHTVLREAGDELERLYQSDFAEMSKQLHLTSIT
AHQRFTAVIDELFRDGVNWGRIIAFFEFGGTVCVECVNKEMTAHVDNIASWMTEYLNGPLHGWIQENGGWRCASSDWPIA
LSVRMRQPMSGGDWSHPSHASAVKPSMTAAVCSRAEGVVLLCTTFRTAVDSCKQEDV
>gnl|bcl2dbpro|A0A673LTJ0_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous (length=198 residues).
MRFDCCLRNCRWRAQSDIAGRKMSCWLREQTLLLAEDYISFCSGIQQTPPSESAEAMRYLAKEMEQQHRTKFRSLSQEFL
DTCGSDPSKCLQRVMRELVGDGKLNWGRVVSIFTFTGVLASELLSRGENSDCSRRLAETIADYLGGEKQDWLVENGGWEG
FCTFFHNARQLNQESSMKTALFAAAGVGLAGLTFLLVR
© 1998-2020Legal notice