Dataset for protein Unclassified of organism Sinocyclocheilus anshuiensis

[Download (right click)]

10 sequence(s)

>gnl|bcl2dbpro|A0A671KNQ2_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis (length=210 residues).
MAQENVYDNRRIVVKYIHHKLWKKGYVWEENGHDDSVSNGLMMERQEDGGISPSSRHDPCRALHKVLREAGDELERLYQS
DFAEMSKRLHLTSITAHQRFTAVIDELFRDGVNWGRIIAFFEFGGTVCVECVNKEMTAHVDNIAGWMTEYLNGPLHGWIQ
ENGGWEAFVELYGRQRDSVFRSSWSSIVTVFGLAALGAVGLTIGAYLAQK
>gnl|bcl2dbpro|A0A671L8S3_uncMCL1-02 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis (length=208 residues).
MTLSLGNRPMAALGVLAEEADAALKPLRPGTNGLKGLQLDGRFVSAGDGSLPATPDPQELGSDTRQLLLDFYRTHTGMSL
PDRKRHHALPTMKRVVADVVIKHQITYRGMLQHLQLDSQPDDLSFIGCIAKTMFRDDTTNWGRIVSLVAFGAVVCSQMKE
LQRERCVETVAQQISSYLISEQHDWLLNNKVICVTSWSLWLAVNSTAC
>gnl|bcl2dbpro|A0A671L8S3_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis (length=230 residues).
MGLFQPQPVRNNSKGTNEVIPGKRLVGSPYKALRGGVMEHAMTRGLYKSVQRRSYFRFALQTRVSTNTSTISFTDYALTF
NSILSFFFLHISLSFRHHALPTMKRVVADVLLKCLGFSAGMLQHLQLDSQPDDLSFIGCIAKTMFRDDTTNWGRIVSLVA
FGAVVCSQMKELQRERCVETVAQQISSYLISEQHDWLLNNKGWVSDTRGKSHSYWIRPVFHSFQLHFMAV
>gnl|bcl2dbpro|A0A671L8S3_uncMCL1-03 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis (length=296 residues).
MGLFQPQPVRNNSKGTNEVIPGKRLVGSPYKALRGGVMEHAMTRGLYKSVQRRSYFRFALQTRVSTNTSTISFTDYALTF
NSILSFFFLHISLSFRHHALPTMKRVVADVLLKCLGFSAGMLQHLQLDSQPDDLSFIGCIAKTMFRDDTTNWGRIVSLVA
FGAVVCSQMKELQRERCVETVAQQISSYLISEQHDWLLNNKGWSTKTETKIKTILTFASLETIVNEYKIKILFFTCIYFY
ISLCINLYIYLFLILSGVAFHTFTGKVKLRLSQFLSAVNKWGNKVTCVTYLKNILL
>gnl|bcl2dbpro|A0A671MWU9_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis (length=266 residues).
MFHFSELFSVRERFFRYDVLRITDFFLLALVLSRLITMATEIRFDNRNIVEKYINHKLSKKGYVWKSQSSGEDDDTVNKG
VEGSSLNSDRRLQAPSAGGGNNSECLIAHRVTRSDAYSRIYRALHEAGDEIERIYQREFEEMSHRMIFSPNTTQRSFLAV
AEELFKDGVNWGRIIAFFEFGGTMCVESVNREMASQVDNIAHWMTDYLNGPLENWIEENGGWDAFVELYSQQRDSMFHPF
SYLTKVLGLAVLGLAGVTIGAFFAQK
>gnl|bcl2dbpro|A0A671Q0S3_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis (length=229 residues).
MANEIRYDNRNIVEKYLNHKLSKKGYEWKFQSSGEDDDTINTGVEDSSPNSGRRLQAPSAGGGNNSECLIANRVTRSDPY
SRIYGALREAGDQIERMHQREFEEMSHQMIFSPNAAQRSFLAVAEELFRDGVNWGRIVAFFEFGGTMCVESFNREMASQV
DNIAHWMTDYLNGPLENWIEENGGWDAFVELYSQQRDSMFHPFSYLTKVLGLAALGLAGVTIGAFFAQK
>gnl|bcl2dbpro|A0A671QD94_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis (length=201 residues).
MKGAVNGHDDSVSNGLMMERQEDRGGSRHDPFSALHTVLREAGDELERLYQSDFAEMSKQLHLTSITAHQRFTAVIDELF
RDGVNWGRIIAFFEFGGTVCVECVNKEMTVHVDNIAGWMTEYLNGPLHGWIQENGGWVYAGSLAPPLLLRSKHLCHNSAH
ERSYFERAKVRFAHAQTEFCGENVCLTKKKVFRAHENQFCI
>gnl|bcl2dbpro|A0A671QD94_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis (length=200 residues).
MCNVYDNRSIVVKYIHHKLWKKGYVWEVNGHDDSVSNGLMMERQEDRGGSRHDPFSALHTVLREAGDELERLYQSDFAEM
SKQLHLTSITAHQRFTAVIDELFRDGVNWGRIIAFFEFGGTVCVECVNKEMTVHVDNIAGWMTEYLNGPLHGWIQENGGW
CSLNANGFLTQHNPAQSQHSLHYHDSRRGKIQCMHNYYAS
>gnl|bcl2dbpro|A0A671QNL7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis (length=179 residues).
KDQVQRAGTCAPSLPEPQPMSWQFHNIKSKLNVAITVNKIEMFYFIMFNFSLIDGFAHVVDRQSFQRLAEKVFVDDITWA
KIVTLICVVGKTVAKILANSVPGIVSWTLDYFQNNLQNWICSMGGWINSSSSLAHYSFEREFGSLSEIRLTDQISLSSGV
LLISAVLSGFIIWRITRGD
>gnl|bcl2dbpro|A0A671QSU5_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis (length=173 residues).
MTKSQINIHNPLKLKWQFHNIKSKLNVAITVNKIEMFYFIMFNFSLIDGFAHVVDRQSFQRLAEKVFVDDITWAKIVTLI
CVVGKTVAKILANSVPGIVSWTLDYFQNNLQNWICSMGGWINSSSSLAHYSFEREFGSLSEIRLTDQISLSSGVLLISAV
LSGFIIWRITRGD
© 1998-2020Legal notice