Dataset for protein BCL-2-like of organism Serinus canaria

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C9MG30_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Serinus canaria GN=BCL-2 (length=297 residues).
MKCDGLYFKAFTQKSVFPPFYFKKFYRCNKSLRIRDGCSCLSRRLFGSPIPSCRTCLLCSSAVSSEKLLSNPFSQSRKTG
HGRHCLSHKHRGYDNREIVLKYIHYKLSQRGYDWPASEDRASLPPGLSAPAAAAVAAAAGTSSDHTGLVSPHPEPPGSAA
ASHAPPAEGLRPAPQVVHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIVAFFEFGGV
MCVESVNREMSHLVDSIATWMTEYLNRQLHNWIQDNGGWVSPPTARFLCRLRPLAGG
>gnl|bcl2dbpro|A0A8C9MQN0_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Serinus canaria GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRTMASSLQDQTEEALRPLLDRIDITSVAVAKRIFNGVMEEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
ALFIAVVSLFREYY
>gnl|bcl2dbpro|A0A8C9NN65_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Serinus canaria GN=BCL2L1 (length=230 residues).
MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEMDGVLNGSPSWHAATSHIVNGATVHQSSLEVHEIRRA
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVVKEMRVLV
KRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEVRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8C9NTQ6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Serinus canaria GN=MCL-1 (length=186 residues).
MEQTAFCRAPGVPHRPFWLLPWRPTCGTLSRSLNEGCGCPGLPAAGAGSCGPTLLILAPAPVGFAGMLRRLQIQQEEDLQ
SVVEVAAQMFSDGVTNWGRVVTLITFGAFVAKHLKSIQQEQSISSLAGIITDALVSSKREWLESQGGWEGFVDFFRVEDL
EGSIRNVLMAFAGVAGLGASLAYMIR
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice