Dataset for protein Unclassified of organism Salmo trutta

[Download (right click)]

5 sequence(s)

>gnl|bcl2dbpro|A0A673XRF5_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Salmo trutta (length=216 residues).
MTAILLPSVRGESSLIAGRTMSCGLWKETLAIAEDYLSVCSIIPASGSRKAPPGPPPSDSAAAMRRQARDMEAKHRARFH
ALAHSFLCQCGPDPCACLRRVMEELVGDGQMNWGRVVSLFTFTGVLVRELQGEDKDQGLGNGMGLGGKESCRALAGTIAD
YLGEEKSDWMLENKGWEGFCKFFHTAREVNQDSSMKTALFAAAGVGIAGLTFLLVR
>gnl|bcl2dbpro|A0A673Y348_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo trutta (length=191 residues).
PLCCLQHPHHPGKISHQETYHHQTGALDIDTRQLIKCVLGQCTGLLKPRWNESKALSTTSRVIGQLLEKHRYTYNGMINT
LYVDDRGDDVKFLSSVAHIIFEDGTVNWGRVASLMSFGAAVCQYLRGKGRDDCVDVVGEEIAEYLATHHTDWLNGFAEFF
LVAEPESRCRNIIMTLFGLAGIGATMTFLVM
>gnl|bcl2dbpro|A0A674BFJ1_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo trutta (length=250 residues).
MLRFQSGLLAFPEFKLYSNVGYVTIAGTKHCIICASPPGQDHYIACPEIGNLLKTKLKHLKLSGSIDSTPLFTRRGPGHE
YSWGALDTDTRQLIKCVLGQCTGLLKPRWNESKALSTMSRVVGQLLEKHRYTYNGMINTLYVDDRGDDVKFLSAVAHIIF
QDGTVNWGRVASLTSFGAAVCQYLKDKGRDNCVEVAGEEISAYLVTHHKDWLNGFVEFFPVAEPESRSRNIIMTPVGLAG
IGAAMTLLVM
>gnl|bcl2dbpro|A0A674C6K2_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Salmo trutta (length=216 residues).
MTAILLPSVRGESSLIAGRTMSCGLWKETLAIAEDYLSVCSIIPASGSRKAPPGPPPSDSAAAMRRQARDMEAKHRARFH
ALAHSFLCQCGPDPCACLRRVMEELVGDGQMNWGRVVSLFTFTGVLVRELQGEDTDQGLGNGMGLGGKESCRALAGTIAD
YLGEEKSDWMLENKGWEGFCKFFHTAREVNQDSSMKTALFAAAGVGIAGLTFLLVR
>gnl|bcl2dbpro|A0A674EJX0_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Salmo trutta (length=195 residues).
MANDDNRCIVEKYICHKLLKRGYAWDFENAEDEEDADNNGSMISPPPAIHRVLREAGDELERLYQPDFAEMSHQLYLTSS
MAERRFREVIDELFRDGVNWGRIVAFFEFGGTICVECVNKEMTSQVDHIAGWMTEYLNGPLHSWIQENGGWEAFVELYDR
QRDSMFCSWPSIKTVFGLAALGAASLTIGAYLTQK
© 1998-2020Legal notice