Dataset for protein Bcl-2 of organism Salarias fasciatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A672HHE5_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Salarias fasciatus GN=BCL-2 (length=230 residues).
MENERNRNIVVKYICHKLSKRGYAWSLDAARDEDADNNGSLVDPEPTLVRRCREAAGAGPDSEDDSPRLCRRPQQSDPHA
AIHRVLREAGDELERLYQPDFTEMSRQLYLTSSTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECVSKEDMTAQV
DNIADWMTEYLNGPLDSWIRDNGGWDAFVDLYDRQRESVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
© 1998-2020Legal notice