Dataset for protein Unclassified of organism Rhinopithecus bieti

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K6LPH6_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Rhinopithecus bieti (length=145 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAA
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K6LPH6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Rhinopithecus bieti (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2020Legal notice