Dataset for protein Bfl1 of organism Pseudonaja textilis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A670YDS2_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Pseudonaja textilis GN=BCL2A1 (length=173 residues).
MESYNFLYVNTLVQDYLKYICQEAQLAAAPNKVAEVLRKAGSSAQKEVEGNLRPYVDSLGIHSIEEAGNIFHQVMENEFA
DGKINWGRILTIFLFGGILAKKLQGPLAKENLKQISYFITDYIVSTKGKWISENGGWDNGFITKFEDRNSWVSLSTLKTK
ILAVFSIFNQYHS
© 1998-2020Legal notice