Dataset for protein Bcl-2 of organism Pseudonaja textilis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A670ZV01_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Pseudonaja textilis GN=BCL-2 (length=222 residues).
MMAHPGIRDYSNREIVLRYIHYKLSQKGYDWVASGDRENVSPAVGTFPALGGLVPLPSAAVSNLAATEEHPVPQVVYSTL
CQAGDEFSRRYQRDFTQMSGQLHLTPVTARSHFMAVVEELFRDGVNWGRIVAFFEFGGMLCVESVSREMSPLVDSIAEWM
TEYMNRHLHNWIQDNGGWDAFVELYSNNIRPLFDLSWLPLKTILSLAVVGACITLGAYLGHK
© 1998-2020Legal notice