Dataset for protein Bcl-2 of organism Prolemur simus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C9AC52_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Prolemur simus GN=BCL-2 (length=236 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPAAPRDPAARTSPPAAPAAAAG
PALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice