Dataset for protein Bcl-2 of organism Podarcis muralis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A670IB81_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Podarcis muralis GN=BCL-2 (length=232 residues).
MMAQTGIRGYDTREIVQTYIHYKLSQKGYDWVASEDREDLPSPPLPPDPPAAETFPNLARLASHPSELPVSNVAPAGGPH
PVPQVVHATLRQAGDEFSRRYRRDFAQMSGQLHLTPVTARARFAAVVEELFRDGVNWGRIVAFFEFGGMMCVESVSREMS
PLVDNITVWMTDYLNGHLDNWIQDNGGWDAFVELYSNNMRPLFDFSWLPLKTILSLAVVGACITLGAYLGHK
© 1998-2020Legal notice