Dataset for protein Mcl-1 of organism Phocoena sinus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C9BA52_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Phocoena sinus GN=MCL-1 (length=198 residues).
MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLLATGTKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGML
RKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGW
DGFVDFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C9BA52_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Phocoena sinus GN=MCL-1 (length=351 residues).
MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLLAAGKEATAGREVGGGEAGEVIGGSAGPSPPATLAADARRVARP
SPIGAEGPDVTATPARLLFFAPTRRASPPEEMESSVSDAIMSPEEELDGCEPEPLGKRPSVLPLLELVGEASNSPGKDGS
LPSTPPPAEEEEDELYRQSLEIISRYLREQATGTKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVDFF
HVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice