Dataset for protein Mcl-1 of organism Phasianus colchicus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A669R428_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Phasianus colchicus GN=MCL-1 (length=179 residues).
MFAVKRNAVIGFNLYCGGGGPGGPGRPGRTGGAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIKKEEDLQAVCEVAA
NVFSDGVTNWGRVVTLISFGAFVAKHLKSINQEKCISSLAGIITDALVSSKREWLMSQGGWEGFVDFFRVEDLESSIRNV
LMAFAGVAGLGASLAYMIR
© 1998-2020Legal notice