Dataset for protein Unclassified of organism Phallusia mammillata

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6F9DJR1_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Phallusia mammillata (length=215 residues).
MVHKTRRIVERYIFNKVKSLLNNTPQQFESHLSIIYQSDNNPSPVHLAVQRAAENYEIRYKEAFPDLMDQMRTTNTTTED
IEGLFTKISTELFQLHKKESDTTNVNGELIKWGHVMALFVFAGVLATRAVELNSLHQVDSIISWVTDFLDQDLSSWLKRQ
GGWENFIEWAEKLDNSNQEDIQNLPPNFGQGMRSLMGVGVLAACVGLGAVFLIHK
© 1998-2020Legal notice