Dataset for protein Unclassified of organism Pavo cristatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C9LEK7_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Pavo cristatus (length=169 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVEVAKRIFNGVMEEKFA
DGNTNWGRITTIFTFGGLLTKKLQEHGXFIAKFSSKEVQIILIFLQCSYTNIFGKKTIKICIFKSYGGPHLFQKKNCRMG
EGGRSTWLR
© 1998-2022Legal notice