Dataset for protein Bcl-2 of organism Panthera tigris altaica

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C9J3W6_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL-2 (length=166 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAXXXXXXXXXXAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDF
AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDN
GGWVGA
© 1998-2022Legal notice