Dataset for protein Unclassified of organism Pan paniscus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2R9B9U7_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Pan paniscus (length=79 residues).
MVRSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCETGLIFLTLMKTIANTYFYF
© 1998-2020Legal notice