Dataset for protein Mcl-1 of organism Otus sunia

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C8B1M7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Otus sunia GN=MCL-1 (length=429 residues).
MVQAASTACPVPGDSGTAGGGGAGVCVAARGGPALLRGCCTGLRTAGARQHRGAGGXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELDGFEPEAERGPAGDSLPGTPPGPPAPPDGL
RQDSLELISRYLREAAGEAEPGAKKLFPGLLGGPGRPGGSGDAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIQKEE
DLQSVCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSINQEKCISSLAGIITDALVSSKREWLLSQGGWEGFVDFFRV
EDLEGSIRNVLMAFAGVAGLGASLAYMIR
© 1998-2022Legal notice