Dataset for protein Unclassified of organism Ornithorhynchus anatinus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A6I8PDU7_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ornithorhynchus anatinus (length=201 residues).
MAQPGTSGDAHRDLVVKFIGYKLAQRGYHWEPSGGSAAPAPAPRLRPPPPAVHLALRRAGDHFSRRYRRDFADMSGQLHL
TPSTARARFAAVVDELFRDGVNWGRIVAFFEFGGALCVESVHREMASPVDGIAQWMTDYLGRRLHPWIQEHGGWVWAHKG
PAPDLFRARSGWTVVGSLTPVLPLGGRAPVRRPAAFPGLHR
>gnl|bcl2dbpro|A0A6I8PDU7_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ornithorhynchus anatinus (length=198 residues).
MAQPGTSGDAHRDLVVKFIGYKLAQRGYHWEPSGGSAAPAPAPRLRPPPPAVHLALRRAGDHFSRRYRRDFADMSGQLHL
TPSTARARFAAVVDELFRDGVNWGRIVAFFEFGGALCVESVHREMASPVDGIAQWMTDYLGRRLHPWIQEHGGWDAFVEL
YGEPARPRLDLSWFSLKTLLSLVVVGACITLGAYFGHK
© 1998-2020Legal notice