Dataset for protein Bcl-xL of organism Ornithorhynchus anatinus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6I8PIR3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ornithorhynchus anatinus GN=BCL2L1 (length=204 residues).
MSLRNYDLVRDFVSYKLAQRGHDWSRLVDPEAPDTGAEGAEGGRAAPAAAEDDDEAVRRTLREAGDEFEVRYRRAFSDLA
WQLHITPATAYQSFEQVVNELFRDGVNWGRVVAFFAFGGALCVESADKEMGPLVGRVGSWMATYLDRRLDPWIRDNGGWD
TFVELYGNDAAAQSRKDQERFNRWLLTGLTVAAVLLLGSLFTRK
© 1998-2020Legal notice