Dataset for protein Unclassified of organism Oreochromis aureus

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A668RK88_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Oreochromis aureus (length=197 residues).
MQCSNRELVEFFISYKLSQKNHPTSLLRPTNGGQRTERDLAQSLPAYNGIEALKSALLDSGEQFGFLFTQSFRDVASHLS
ITPDTAQQCFESVMEELFRDGINWGRIIGLFVFGSAMCLDCIDSNMSELVPNIADWMTAYLDDHISLWIQRNGGWDRFTE
IFGKGMSTRSSGESLKRWLFVGVALVTGLLVGMLMTD
>gnl|bcl2dbpro|A0A668RNM6_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Oreochromis aureus (length=149 residues).
MTEHNHSVAYQDSVDTLLLTVLDGTIAHPTQQCVANKGRAFRVLKRAVRMLSLQTTAAEVPMVTGVARALFSDGIINWGR
VVSLVAYGTVLLRASKSTLGPECAYEIGVSIAAYITDNHMDWLVGSEGWVLQIASTTFIYLVLFHINSC
>gnl|bcl2dbpro|A0A668S1P6_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oreochromis aureus (length=200 residues).
GAMAAAYNSRDLVEDFLRYKLLGRGVAWPQRRANDVRAPRPDPPVAPPRLQAVLRSASDELERLHGNELSAQVTVLRLRG
NGGGAARRRHLTAIREELFRDGVNWGRIVTMMELGGALSAAAAKSGDEGQVDDIASWMEESLDSPSLRRWIHDNGGWDAF
VELYESRPTDSFWSLRTVLGLVVLGAVGVILGFLFSQKQN
© 1998-2020Legal notice