Dataset for protein Bcl-xL of organism Oreochromis aureus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A668RI12_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oreochromis aureus GN=BCL2L1 (length=232 residues).
MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPLNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRQQQPPSTTDL
DAVKEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLV
GRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
© 1998-2020Legal notice