Dataset for protein Unclassified of organism Ooceraea biroi

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A026W6Y7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Ooceraea biroi (length=294 residues).
MAGDDGTTTNNEILDAGVGEEGQDTSARGELHSRVGGILECDPPGNRNSSNERAAAAATTTITTTTTTTNTATAADDDED
GVCRYAVGAANRAMSFFEMCQIRLQHLFPQLGPPPRYNIQDDSIESTAESLAYDVMRYLLKEDIYLVSQDPVSRTMRHNV
YQMLNKHSILFTSMVNRLNVVPDTAYETFMGVANELFLHDVITWARIICLYAFMGRLALWARDRRMHNLKNKLPLYVSRY
VGENITHFVKGYGGWEYLCVEYPVVEEISSAVWRNLLMTGVTLGLIATILSVTS
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice