Dataset for protein Unclassified of organism Oncorhynchus tshawytscha

[Download (right click)]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C8C5D7_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oncorhynchus tshawytscha (length=225 residues).
MANDDNRFIVEKYICHKLLKRGYAWDFEDAEEEEGAANNGSMISPRPGLARRCHGANNAGPGSVPRLSKWLSQPDPHAAI
HRVLREAGDELERLYQPDFAEMSHQLYLTSSTAERRFREVIDELFRDGVNWGRIIAFFEFGGTICVECVNKEMTSQVDHI
AVWMTEYLNGPLLNWIQENGGWVCLYDIQRDSVVLFVSQSINQTVFGLAALGAASLTIGAYLTQT
>gnl|bcl2dbpro|A0A8C8F4M7_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oncorhynchus tshawytscha (length=230 residues).
MMANDNPYNSRFIVEKYIHHKLLKKGFVWEFYPENDSPNNGFGEPSPPNSPEVFARRSQPYAEGVDTDSPLQNRIPQPDR
HARLHRVLREAGDEIEIMYQRDFAEMSGQLHFTPSTAQRRFTAVIEELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQ
VDNIAHWMTEYLNGPLQNWIQENGDWDAFVEIYGQQRISAFHSWPYLKTVFGLAALGAAGVTIGALFIQK
>gnl|bcl2dbpro|A0A8C8F4M7_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oncorhynchus tshawytscha (length=217 residues).
MMANDNPYNSRFIVEKYIHHKLLKKGFVWEFYPENDSPNNGFGEPSPPNSPEVFARRSQPYAEGVDTDSPLQNRIPQPDR
HARLHRVLREAGDEIEIMYQRDFAEMSGQLHFTPSTAQRRFTAVIEELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQ
VDNIAHWMTEYLNGPLQNWIQENGDWLLYLPSPPQAMRAEESEEMNQEEFEKRREPS
>gnl|bcl2dbpro|A0A8C8FMH0_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus tshawytscha (length=174 residues).
MSSCRPCMRAVERNPAIAEDTSPPGPPPSDSAAAMRRQARDMEAKHRAPSMPGTQLPVPMRAGPLRLSEEGDGGAGGRWT
DELGEVVSLFTFTGVLVRELQGEDTDRGCRALGGDQADYLGEEKSDWMLENKGWEGFCKFFHTAREVNQDSSMKTALFAA
AGVGIAGLTFLLVR
© 1998-2023Legal notice