Dataset for protein Unclassified of organism Oncorhynchus mykiss

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C7TTA8_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oncorhynchus mykiss (length=211 residues).
MANDDNRFIVEKYICHKLLKRGYAWDFEDAEEEEGAANNGSMISPRPGLARRCHGANNAGPGSVPRLSKWLSQPDPHAAI
HRVLREAGDELERLYQPDFAEMSHQLYLTSSTAERRFREVIDELFRDGVNWGRIIAFFEFGGTICVECVNKEMTSQVDHI
AVWMTEYLNGPLLNWIQENGGWALHTPPVLCLFLPLLRRAIGMSAAQELTT
© 1998-2022Legal notice