Dataset for protein Unclassified of organism Oncorhynchus mykiss

[Download (right click)]

6 sequence(s)

>gnl|bcl2dbpro|A0A8C7TTA8_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oncorhynchus mykiss (length=211 residues).
MANDDNRFIVEKYICHKLLKRGYAWDFEDAEEEEGAANNGSMISPRPGLARRCHGANNAGPGSVPRLSKWLSQPDPHAAI
HRVLREAGDELERLYQPDFAEMSHQLYLTSSTAERRFREVIDELFRDGVNWGRIIAFFEFGGTICVECVNKEMTSQVDHI
AVWMTEYLNGPLLNWIQENGGWALHTPPVLCLFLPLLRRAIGMSAAQELTT
>gnl|bcl2dbpro|A0A8C7UTW0_uncMCL1-02 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus mykiss (length=146 residues).
SPSREGTYLPKDITLTHVCAMDVTGMINTLYVDDRGDNVKFLSAVAHSIFEDGTVNWGRVASLTSFGAAVCRYLRGKGRD
NCVDLVGEEISEYLVTHHKDWLVKHNSWTGFVEFFPVAEPESRCRNIIMTIFGLAGIGATMTFLVM
>gnl|bcl2dbpro|A0A8C7UTW0_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus mykiss (length=131 residues).
IHVCAMDVTGMINTLYVDDRGDNVKFLSAVAHSIFEDGTVNWGRVASLTSFGAAVCRYLRGKGRDNCVDLVGEEISEYLV
THHKDWLVKHNSWTGFVEFFPVAEPESRCRNIIMTIFGLAGIGATMTFLVM
>gnl|bcl2dbpro|A0A8C7V132_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Oncorhynchus mykiss (length=240 residues).
MPFFVTSLSEYKVWREPGEAEIRLMTAILLPSVRGESSLIAGRTMSCGLWKETLAIAEDYLSVCSIIPASGSRKAPPGPP
PSDSAAAMRRQARDMEAKHRARFHALAHSFLCQCGPDPCACLRRVMEELVGDGQMNWGRVVSLFTFTGVLVRELQGEDTD
QGLGNGMELGGKESCRALAETIADYLGEEKSDWMLENKGWEGFCKFFHTAREVNQDSSMKTALFAAAGVGIAGLTFLLVR
>gnl|bcl2dbpro|A0A8K9UQL8_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oncorhynchus mykiss (length=193 residues).
MANDDNRCIVEKYICHKLLKIGYAWDFENAEEDADNNGSMISPPPAIHRVLREAGDELERLYQPDFAEMSHQLYLTSSMA
ERRFREVIDELFRDGVNWGRIVAFFEFGGTICVECVNKEMTSQVDHIAGWMTEYLNGPLHNWIQENGGWEAFVELYDRQR
DSVFCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A8K9X1Z8_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Oncorhynchus mykiss (length=240 residues).
MPFFVTLLSEYKVWREPGEAEIRLMTAILLPSVRGESSLIAGRTMSCGLWKETLAIAEDYLSVCSIIPASGSRKAPPGPP
PSDSAAAMRRQARDMEAKHRARFHALAHSFLCQCGPDPCACLRRVMEELVGDGQMNWGRVVSLFTFTGVLVRELQGEDTD
QGLGNGMELGGKESCRALAETIADYLGEEKSDWMLENKGWEGFCKFFHTAREVNQDSSMKTALFAAAGVGIAGLTFLLVR
© 1998-2023Legal notice