Dataset for protein BCL-2-like of organism Oncorhynchus mykiss

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A060XE41_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus mykiss GN=BCL2L1 (length=219 residues).
MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGRTDGDEAIANGSVGNYRNSRSNLAKPSSPQGGMEPVKAALRDSVDE
FELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDN
HIQPWIQSQGGWDRFAEIFGRDAAADVRRSQESIIKWLLVGVILLSGVLVGTLIMKKRQ
>gnl|bcl2dbpro|A0A286MU87_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus mykiss GN=BCL2L1 (length=216 residues).
MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGRTDGDEAIANGSVGNYRNSRSNLAKPSSPQGGMEPVKAALRDSVDE
FELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDN
HIQPWIQSQGGWAEIFGRDAAADVRRSQESIIKWLLVGVILLSGVLVGTLIMKKRQ
>gnl|bcl2dbpro|A0A8C7P574_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus mykiss GN=BCL2L1 (length=234 residues).
IMTYNNRELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGDEGGQVEGGAAVTTHPNGTVNGTSPGTPPRQSPPSSPQRTM
GLDAVKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSP
LVGRIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAESRKSQESFKKWLLAGMTLVTGVIVGSLIAQKRL
>gnl|bcl2dbpro|A0A8C7PM33_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus mykiss GN=MCL-1 (length=291 residues).
MSLSKSITRATTTMLNFQNGVVGGSSYPAGTSLYYFGETGAVRAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVL
GNHLSDRSNNDDSDGSLPCTPQVASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLSPSRCKQSKALTTMKKVVKDI
IAKHRYAYNGMIAKLDLDDRCDDMSFINSVATTMFSDGTTNWGRIASLVAFGAVVSQHLKEMGRGHCIESVGQKIATYLL
SDQRDWLVKNNAWNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLVR
>gnl|bcl2dbpro|A0A8C7PM33_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus mykiss GN=MCL-1 (length=310 residues).
MSLSKSITRATTTMLNFQNGVVGGSSYPAGTSLYYFGETGAVRAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVL
GNHLSDRSNNDDSDGSLPCTPQVASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLSPSRCKQSKALTTMKKVVKDI
IAKHRYAYNGMIAKLDLDDRCDDMSFINSVATTMFSDGTTNWGRIASLVAFGAVVSQHLKEMGRGHCIESVGQKIATYLL
SDQRDWLVKNNAWNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLVSLLDYSGGLNWDSALVSSSS
>gnl|bcl2dbpro|A0A8C7PM33_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus mykiss GN=MCL-1 (length=295 residues).
MSLSKSITRATTTMLNFQNGVVGGSSYPAGTSLYYFGETGAVRAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVL
GNHLSDRSNNDDSDGSLPCTPQVASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLSPSRCKQSKALTTMKKVVKDI
IAKHRYAYNGMIAKLDLDDRCDDMSFINSVATTMFSDGTTNWGRIASLVAFGAVVSQHLKEMGRGHCIESVGQKIATYLL
SDQRDWLVKNNAWNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLVRNSED
>gnl|bcl2dbpro|A0A8C7RD80_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus mykiss GN=BCL2L1 (length=219 residues).
MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDEAIANGSLGNNRNGRSNLGMPSSAQGGIEAVKAALRDSVDE
FELRYTRAFSDLCSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSHLVTRIADWMATYLDN
HIQPWIHSQGGWDRFAEIFGRDAAADVRRSQESLKKWLLVGVMLLSGVLVGTLIMKKCQ
© 1998-2022Legal notice