Dataset for protein Unclassified of organism Oncorhynchus kisutch

[Download (right click)]

7 sequence(s)

>gnl|bcl2dbpro|A0A8C7CXD6_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oncorhynchus kisutch (length=228 residues).
MMANENPYNSRFIVEKYIHHKLLKVGFVWKFQGENDSPNNGFGDPSTPNSPEVFARRSQPTAAGEDTDSPYQNRSPQPDP
HARLHRVLREAGGEIERMYQRDFAEMSGQLHFTPSTAQRRFTAVIDELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQ
VDNIARWMTEYLNGPLQNWIQENGGWDAFVEIYEQQRISHSWPYLKTVFGLAALGAAGVTIGALFTQK
>gnl|bcl2dbpro|A0A8C7CXD6_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oncorhynchus kisutch (length=209 residues).
MMANENPYNSRFIVEKYIHHKLLKVGFVWKFQGENDSPNNGFGDPSTPNSPEVFARRSQPTAAGEDTDSPYQNRSPQPDP
HARLHRVLREAGGEIERMYQRDFAEMSGQLHFTPSTAQRRFTAVIDELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQ
VDNIARWMTEYLNGPLQNWIQENGGWVCRYWAGGRVCLTSRHCRDFTSC
>gnl|bcl2dbpro|A0A8C7CXD6_uncBCL2-03 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oncorhynchus kisutch (length=209 residues).
MMANENPYNSRFIVEKYIHHKLLKVGFVWKFQGENDSPNNGFGDPSTPNSPEVFARRSQPTAAGEDTDSPYQNRSPQPDP
HARLHRVLREAGGEIERMYQRDFAEMSGQLHFTPSTAQRRFTAVIDELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQ
VDNIARWMTEYLNGPLQNWIQENGGWPLPSMPAGMSLPTGKPTCRNLRR
>gnl|bcl2dbpro|A0A8C7HGG9_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Oncorhynchus kisutch (length=216 residues).
MTAILLPSVRGESSLIAGRTMSCGLWKETLAIAEDYLSVCSIIPASGSWKAPPGPPPSDSAAAMRHQARDMEAKHRARFH
ALAHSFLCQCGPDPCACLRRVMEELVGDGQMNWGRVVSLFTFTGVLVRELQGEDTDQGLGNGMELGGKERCRALAETIAD
YLGEEKSDWMLENKGWEGFCKFFHTAREVNQDSSMKTALFAAAGVGIAGLTFLLVR
>gnl|bcl2dbpro|A0A8C7MJ69_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus kisutch (length=206 residues).
MLYSNDGYVTIAGTKHCMICKSPPGQDHYIACPEIGNRLKTKLKHLKLAGSIDSTPLFTWKGPGHEYTLDTNTRQLIKSV
LGQYTRLLKPGWNESKALSTMSRVVGQLLRKHRDAYNGMINTLYVDDRGDDVKFLSALAHIIFQDGTVNCGRVASLTSFG
TAEISAYLNGFVDFFPVADPESSSRNILMFFVRLAGIGAAVTLLVM
>gnl|bcl2dbpro|A0A8C7MNS2_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus kisutch (length=306 residues).
MACPDIGNRVKATLKHLKVAGSIDSTPLFTSRGPEHEYRWGDLETDSSLAYGSKHFGVLGESANMYHLPNTVDTHKCFMC
NLEIKNFVENDTLLGEHIFHVYNTSGRCKYLTDRYTNREDEMMLLLGKERYRRGKIAFPDSIITNSTGALDTDTRQLIKC
VLGQCTGLLKPRWNESKALSTMSRVIGQLLEKHRYTYNGMINTLYVDDRGDNVKFLSAVAHSIFEDGTVNWGRVASKGRD
NCVDLVGEEISEYLVTHHKDWLVKHNSWNGFVEFFPVAEPESRCRNIIMTIFGLAGIGATMTFLVM
>gnl|bcl2dbpro|A0A8C7MUB2_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Oncorhynchus kisutch (length=216 residues).
MTAILLPSVRGESSLIAGRTMSCGLWKETLAIAEDYLSVCSIIPASGSWKAPPGPPPSDSAAAMRRQARDMEAKHRARFH
ALAHSFLCQCGPDPCACLRRVMEELVGDGQMNWGRVVSLFTFTGVLVRELQGEDTDQGLGNGMELGGKERCRALAETIAD
YLGEEKSDWMLENKGWEGFCKFFHTAREVNQDSSMKTALFAAAGVGIAGLTFLLVR
© 1998-2022Legal notice